PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602472.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 286aa    MW: 32001.8 Da    PI: 8.2955
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602472.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.2e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l++++ ++G+g +W + +++ g++R++k+ ++rw++yl
   XP_009602472.1 14 RGPWSPEEDAKLKEYIDKYGTGgNWIALPQKAGLRRCGKSSRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding383.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ e+d+ +  + ++ G++ W+ Ia+ ++ gRt++++k++w++
   XP_009602472.1  69 GEFSDEDDKVICSLYAKIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.956962IPR017930Myb domain
SuperFamilySSF466896.64E-2511109IPR009057Homeodomain-like
SMARTSM007171.2E-91364IPR001005SANT/Myb domain
PfamPF002495.6E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-211569IPR009057Homeodomain-like
PROSITE profilePS5129421.35663117IPR017930Myb domain
SMARTSM007173.3E-1167115IPR001005SANT/Myb domain
PfamPF002497.7E-1169111IPR001005SANT/Myb domain
CDDcd001679.65E-870113No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRAPCCDKE NVKRGPWSPE EDAKLKEYID KYGTGGNWIA LPQKAGLRRC GKSSRLRWLN  60
YLRPNIKHGE FSDEDDKVIC SLYAKIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMPL  120
VSSPQQIRPF HQTTCHSSIS PLQANSSLVS SLYSSISPAL SLATTAHKYT SSHFYPTSTA  180
TNFPGYETNI ISTQSSSFLS TCSCSSGGEK LVSYLNDGVD EKQNSSKFSI TNGSTNKYAE  240
EKPSGKGCYE EENQLECSLE EIKQLISTTS IYNNYTNFFL DENRTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602472.10.0PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL21e-75MYB36_ARATH; Transcription factor MYB36
TrEMBLK4CQL42e-99K4CQL4_SOLLC; Uncharacterized protein
STRINGSolyc09g008250.2.16e-99(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-75myb domain protein 36